WP_003484013.1 has 189 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-14 40.5 0.2 6.6e-14 38.4 0.0 2.0 2 WP_003484013.1
Domain annotation for each sequence (and alignments):
>> WP_003484013.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 38.4 0.0 6.6e-14 6.6e-14 11 79 .] 37 105 .. 35 105 .. 0.96
2 ? -0.7 0.1 0.11 0.11 1 16 [. 129 144 .. 129 148 .. 0.90
Alignments for each domain:
== domain 1 score: 38.4 bits; conditional E-value: 6.6e-14
CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
l++ + +R ++ +++a K ++g+pvld++Re++vl+ +r++a ++gld++ ++++f + i++ +++Q+
WP_003484013.1 37 LMDRIVQRNAIGDAVALSKWDSGKPVLDQAREAAVLQSVRDQAPAHGLDADDAARFFGAQIEANKSVQY 105
678899***********************************************************9996 PP
== domain 2 score: -0.7 bits; conditional E-value: 0.11
CM_2 1 RkeIdeiDrelleLla 16
R+++d++ ell+ la
WP_003484013.1 129 RARLDQLQGELLDALA 144
8999********9997 PP
Or compare WP_003484013.1 to CDD or PaperBLAST