WP_003664568.1 has 88 amino acids
Query: DUF4212 [M=79]
Accession: PF13937.10
Description: Domain of unknown function (DUF4212)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-35 106.4 3.7 4.5e-35 106.2 3.7 1.0 1 WP_003664568.1
Domain annotation for each sequence (and alignments):
>> WP_003664568.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 106.2 3.7 4.5e-35 4.5e-35 3 78 .. 11 85 .. 9 86 .. 0.97
Alignments for each domain:
== domain 1 score: 106.2 bits; conditional E-value: 4.5e-35
DUF4212 3 aYwranlrlililLviWflvsfglgilfaeelntirtflgfplgFwfaaqgsilvfvvlifvYalrmnrlDrkygv 78
Yw an+r+i+i+L+iW+lvs g++i++++ l+ i+ f+g +lgFwf++qgsil+f++lif+Y +rmn+l++++g+
WP_003664568.1 11 GYWAANVRIITICLIIWALVSHGFAIWLRPMLSGIQ-FGGADLGFWFGQQGSILCFILLIFFYSWRMNKLEERFGI 85
7**********************************6.*************************************98 PP
Or compare WP_003664568.1 to CDD or PaperBLAST