WP_003857447.1 has 71 amino acids
Query: DUF3046 [M=62]
Accession: PF11248.12
Description: Protein of unknown function (DUF3046)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
5.9e-30 89.8 0.1 6.8e-30 89.6 0.1 1.0 1 WP_003857447.1
Domain annotation for each sequence (and alignments):
>> WP_003857447.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.6 0.1 6.8e-30 6.8e-30 1 62 [] 1 61 [. 1 61 [. 0.99
Alignments for each domain:
== domain 1 score: 89.6 bits; conditional E-value: 6.8e-30
DUF3046 1 MRlteFwelveeeFGsayaeslardhvlselggrTaeeAleaGvdprdVWralcdafdvPee 62
MRl+eF++l+e+eFG+a++e++a++hv+ +l g Ta+ A++ Gvd+rdVW++lc +f vPee
WP_003857447.1 1 MRLSEFRQLIEDEFGEAKGEWIAHSHVIGAL-GVTADVAVDTGVDLRDVWEQLCIDFSVPEE 61
*******************************.****************************96 PP
Or compare WP_003857447.1 to CDD or PaperBLAST