WP_004260670.1 has 254 amino acids
Query: AadA_C [M=103]
Accession: PF13427.10
Description: Aminoglycoside adenylyltransferase, C-terminal domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-29 88.5 0.1 2.2e-29 87.9 0.1 1.3 1 WP_004260670.1
Domain annotation for each sequence (and alignments):
>> WP_004260670.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 87.9 0.1 2.2e-29 2.2e-29 6 102 .. 152 248 .. 149 249 .. 0.96
Alignments for each domain:
== domain 1 score: 87.9 bits; conditional E-value: 2.2e-29
AadA_C 6 vpredlvdailadveelleeieederyvvLtLaRvlatletgeilsKdeAaewalerlPeeyrpllaeArkaylgeeeekweedeeeveefakym 100
v d+++a+l+++++l+ ++++der+v+LtLaR+++t+etg ++sKdeAa wa+e +P e +++l A+kayl +we+++ ev+ +a+y+
WP_004260670.1 152 VGLHDIRRAMLDSLPNLELSLKGDERNVLLTLARMWYTMETGLFISKDEAAIWAIELMPMELASVLLVAKKAYLTGVSVDWENQQVEVTLCANYL 246
55679*****************************************************************************************9 PP
AadA_C 101 la 102
++
WP_004260670.1 247 AE 248
86 PP
Or compare WP_004260670.1 to CDD or PaperBLAST