PaperBLAST – Find papers about a protein or its homologs

 

Align WP_004301517.1 to PF09922 (LiaF-like_C)

WP_004301517.1 has 264 amino acids

Query:       LiaF-like_C  [M=114]
Accession:   PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.1e-15   41.7   0.0    9.6e-15   40.8   0.0    1.5  1  WP_004301517.1  


Domain annotation for each sequence (and alignments):
>> WP_004301517.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   40.8   0.0   9.6e-15   9.6e-15      15      79 ..     176     240 ..     164     255 .. 0.86

  Alignments for each domain:
  == domain 1  score: 40.8 bits;  conditional E-value: 9.6e-15
     LiaF-like_C  15 ediniqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvldeke 79 
                     ++  i + +G ttiDL+ + +  get i +    G v+i+VP+d++v  + +++fG  + +  ++
  WP_004301517.1 176 KGAMIRTSFGGTTIDLRHTHIAPGETYIDLDCSWGGVEIYVPSDWTVVFKCNAFFGGCDDKRWQN 240
                     56678899************************************************998333333 PP



Or compare WP_004301517.1 to CDD or PaperBLAST