WP_004385583.1 has 125 amino acids
Query: DUF525 [M=87]
Accession: PF04379.18
Description: ApaG domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.9e-39 118.8 0.2 5.9e-39 118.5 0.2 1.1 1 WP_004385583.1
Domain annotation for each sequence (and alignments):
>> WP_004385583.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 118.5 0.2 5.9e-39 5.9e-39 2 86 .. 18 102 .. 17 103 .. 0.98
Alignments for each domain:
== domain 1 score: 118.5 bits; conditional E-value: 5.9e-39
DUF525 2 eqsspeeeryvFaYtirienegeesvqLlsrhwiitdangkveevegegVvgeqPvLkpgesfeYtsgvsletpsGsmeGsytmv 86
qsspe+er+vFaYt++++n g+++vqLl r+w it++ngk++ev+gegVvg qP+++pg +++Ytsg+++etp G+m+G+y+mv
WP_004385583.1 18 AQSSPEDERFVFAYTVTVRNLGRTPVQLLGRYWLITNGNGKETEVQGEGVVGVQPHIQPGGEYQYTSGAVIETPFGTMQGHYEMV 102
79**********************************************************************************8 PP
Or compare WP_004385583.1 to CDD or PaperBLAST