WP_004386143.1 has 129 amino acids
Query: DUF3461 [M=125] Accession: PF11944.12 Description: Protein of unknown function (DUF3461) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-60 189.2 2.0 1.6e-60 189.0 2.0 1.0 1 WP_004386143.1 Domain annotation for each sequence (and alignments): >> WP_004386143.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 189.0 2.0 1.6e-60 1.6e-60 1 125 [] 1 125 [. 1 125 [. 1.00 Alignments for each domain: == domain 1 score: 189.0 bits; conditional E-value: 1.6e-60 DUF3461 1 myehLksigitepdeierytLrqeaeadiLkiyfkkekgellaksvkfkfprqrkkilvdsgseeyknvseinatLrqvldeLdkltekekaead 95 my++Lks+git+pdei+ry+Lrqea++diLkiyf+k+kge++aksvkfk+prqrk++ d + yk+v+ei+++Lr+v+deLd+l +++++e+d WP_004386143.1 1 MYDNLKSLGITNPDEIDRYSLRQEANNDILKIYFHKDKGEFFAKSVKFKYPRQRKTVVADGVGQGYKEVQEISPNLRYVIDELDQLCQRDRTEVD 95 9********************************************************************************************** PP DUF3461 96 ikkklLedlkhlervvqdkikeierdlekl 125 +k+k+L+dl+hle+vv++ki+eie dlekl WP_004386143.1 96 LKRKILDDLRHLESVVANKISEIESDLEKL 125 ****************************97 PP
Or compare WP_004386143.1 to CDD or PaperBLAST