WP_004719018.1 has 129 amino acids
Query: DUF1425 [M=96]
Accession: PF07233.16
Description: Protein of unknown function (DUF1425)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-26 77.1 0.0 4.8e-26 76.8 0.0 1.1 1 WP_004719018.1
Domain annotation for each sequence (and alignments):
>> WP_004719018.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 76.8 0.0 4.8e-26 4.8e-26 1 95 [. 35 128 .. 35 129 .] 0.98
Alignments for each domain:
== domain 1 score: 76.8 bits; conditional E-value: 4.8e-26
DUF1425 1 qelvidssvlasrvsveelktrrsngllrasvvlenksktdltlqYrFyWyDedGlevepeaepwqsltlhgkesvtlqavapnprAskfrlyvr 95
q++v++s l++++ + ++ ++ ++g+ a+v+l+n +++++++ YrFyWyD++Gl++ p e+ ++ltl++++++ + +v+pn +A+++rly++
WP_004719018.1 35 QSVVMNSPLLTAGILAGKPVISTQSGRSIATVNLSNGNTKPVKVSYRFYWYDAQGLDLLPF-ETPRTLTLAPGSDIDVVSVTPNLDARRVRLYLF 128
789*********************************************************9.*******************************96 PP
Or compare WP_004719018.1 to CDD or PaperBLAST