WP_004939916.1 has 69 amino acids
Query: DUF2517 [M=61] Accession: PF10725.14 Description: Protein of unknown function (DUF2517) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-39 119.4 1.1 2.5e-39 119.3 1.1 1.0 1 WP_004939916.1 Domain annotation for each sequence (and alignments): >> WP_004939916.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 119.3 1.1 2.5e-39 2.5e-39 1 60 [. 5 64 .. 5 65 .. 0.98 Alignments for each domain: == domain 1 score: 119.3 bits; conditional E-value: 2.5e-39 DUF2517 1 ykeYslhkvlLRRiavvllGilalPvmLfrrdRaRFysYLhrvWlktsdkPvWleqseaa 60 y+ Yslh++lLRR avv GilalPvmLfr+dR RFysYLhrvW+ktsdkPvWl+q+e a WP_004939916.1 5 YHAYSLHRILLRRSAVVIAGILALPVMLFRSDRGRFYSYLHRVWSKTSDKPVWLQQAELA 64 99********************************************************87 PP
Or compare WP_004939916.1 to CDD or PaperBLAST