WP_004939916.1 has 69 amino acids
Query: DUF2517 [M=61]
Accession: PF10725.13
Description: Protein of unknown function (DUF2517)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-39 119.4 1.1 2.5e-39 119.3 1.1 1.0 1 WP_004939916.1
Domain annotation for each sequence (and alignments):
>> WP_004939916.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 119.3 1.1 2.5e-39 2.5e-39 1 60 [. 5 64 .. 5 65 .. 0.98
Alignments for each domain:
== domain 1 score: 119.3 bits; conditional E-value: 2.5e-39
DUF2517 1 ykeYslhkvlLRRiavvllGilalPvmLfrrdRaRFysYLhrvWlktsdkPvWleqseaa 60
y+ Yslh++lLRR avv GilalPvmLfr+dR RFysYLhrvW+ktsdkPvWl+q+e a
WP_004939916.1 5 YHAYSLHRILLRRSAVVIAGILALPVMLFRSDRGRFYSYLHRVWSKTSDKPVWLQQAELA 64
99********************************************************87 PP
Or compare WP_004939916.1 to CDD or PaperBLAST