WP_004948617.1 has 67 amino acids
Query: DUF1656 [M=56]
Accession: PF07869.16
Description: Protein of unknown function (DUF1656)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-24 71.7 8.7 2.4e-24 71.5 8.7 1.1 1 WP_004948617.1
Domain annotation for each sequence (and alignments):
>> WP_004948617.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.5 8.7 2.4e-24 2.4e-24 2 56 .] 7 61 .. 6 61 .. 0.97
Alignments for each domain:
== domain 1 score: 71.5 bits; conditional E-value: 2.4e-24
DUF1656 2 idlgGvyvppllvlallAlvltlllrrllarlglyrlvWhpaLfdlalfvcllgl 56
+ ++G+ +pp+++ +l++l+l++llrrll+ +g+y +vWhpaLf++al++cl++l
WP_004948617.1 7 MVIFGLSFPPVFFELLVSLALFFLLRRLLQPTGIYDFVWHPALFNTALYCCLFYL 61
579*************************************************986 PP
Or compare WP_004948617.1 to CDD or PaperBLAST