WP_005373603.1 has 104 amino acids
Query: DUF496 [M=93]
Accession: PF04363.16
Description: Protein of unknown function (DUF496)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-47 144.6 13.4 4.6e-47 144.4 13.4 1.0 1 WP_005373603.1
Domain annotation for each sequence (and alignments):
>> WP_005373603.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 144.4 13.4 4.6e-47 4.6e-47 1 93 [] 1 93 [. 1 93 [. 0.98
Alignments for each domain:
== domain 1 score: 144.4 bits; conditional E-value: 4.6e-47
DUF496 1 lenvlelvrkarrknklkreiednekkirdnqkrvellenlleyikpdmsieeikaiienmksdyedrvddyiiknaelskerrelskklkel 93
+++v+e+v++arrknklkre+ dnekk+rdn+krv+llenll+yikp+m+++ei aii+nmk+dyedrvdd+iik+ae+sk rr++s++++el
WP_005373603.1 1 MSSVFEIVNQARRKNKLKRELLDNEKKVRDNRKRVDLLENLLDYIKPEMTHDEIVAIIKNMKADYEDRVDDHIIKSAEISKARRDISRRIREL 93
789***************************************************************************************985 PP
Or compare WP_005373603.1 to CDD or PaperBLAST