WP_005414523.1 has 141 amino acids
Query: DUF454 [M=115]
Accession: PF04304.17
Description: Protein of unknown function (DUF454)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.5e-41 127.3 12.1 1.8e-41 127.1 12.1 1.0 1 WP_005414523.1
Domain annotation for each sequence (and alignments):
>> WP_005414523.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 127.1 12.1 1.8e-41 1.8e-41 1 114 [. 22 135 .. 22 136 .. 0.99
Alignments for each domain:
== domain 1 score: 127.1 bits; conditional E-value: 1.8e-41
DUF454 1 rllllvlGllslalGviGivlPlLPTtpFlLlAafcfarssprlerwLlehklfgpyirdwrekraiplkaKvialllmalsllislllveslwv 95
r+ +++l+++sl+ G++Gi++P+LPTt+F+L++a++++r+s+rl++wLl+h++fgp i +w++++a+++ K++a+++ma++++i+l++v+ wv
WP_005414523.1 22 RWAWWLLAYVSLGTGIVGIFVPGLPTTVFILISAWAASRGSERLHNWLLQHPRFGPAIANWQAHGAVSRYGKWMATITMAVCAGIMLWCVPIAWV 116
799******************************************************************************************** PP
DUF454 96 killalvlllvllyllrlp 114
k++ + +++v+++l+++p
WP_005414523.1 117 KWFSIGSMTVVAIWLWTRP 135
*****************98 PP
Or compare WP_005414523.1 to CDD or PaperBLAST