WP_005779318.1 has 82 amino acids
Query: DUF1654 [M=70]
Accession: PF07867.15
Description: Protein of unknown function (DUF1654)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.4e-31 94.3 1.8 1.6e-31 94.2 1.8 1.0 1 WP_005779318.1
Domain annotation for each sequence (and alignments):
>> WP_005779318.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 94.2 1.8 1.6e-31 1.6e-31 1 70 [] 12 81 .. 12 81 .. 0.98
Alignments for each domain:
== domain 1 score: 94.2 bits; conditional E-value: 1.6e-31
DUF1654 1 tsyerlgaRvqriinaPaaQksrvavvlrlegeseedWarlleelaeteevelafqdDgsvrvrWerple 70
+sye++g R+qr+++aP++Qk+++++v r ++e e+ W+ +l e++ete++e+++q Dgsvr++W+r+++
WP_005779318.1 12 SSYEQIGKRIQRLVSAPNVQKTQWVIVARRDDEPEGSWNVVLREIQETEGIEVDPQPDGSVRIGWQRYID 81
59*****************************************************************985 PP
Or compare WP_005779318.1 to CDD or PaperBLAST