WP_007051524.1 has 129 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.7e-18 51.2 0.8 6.7e-18 51.2 0.8 1.6 2 WP_007051524.1
Domain annotation for each sequence (and alignments):
>> WP_007051524.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.3 0.0 0.34 0.34 21 29 .. 24 32 .. 19 33 .. 0.81
2 ! 51.2 0.8 6.7e-18 6.7e-18 1 75 [. 35 109 .. 35 114 .. 0.92
Alignments for each domain:
== domain 1 score: -2.3 bits; conditional E-value: 0.34
CM_2 21 lakeiaeyK 29
a+++a++K
WP_007051524.1 24 TAQAVARIK 32
688999998 PP
== domain 2 score: 51.2 bits; conditional E-value: 6.7e-18
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesr 75
R+ Id+iD+ ++LlaeR++ + +++ +K+++g + d++Re+ ++erl + a ++gldpe++e + ++ e +
WP_007051524.1 35 RQTIDNIDSAVIALLAERFKATSQVGVLKANAGFAPEDTKREDYQIERLHRIAIDAGLDPEIAEMYREFVVTEAK 109
99*************************************************99999*****99877777776665 PP
Or compare WP_007051524.1 to CDD or PaperBLAST