WP_007920905.1 has 86 amino acids
Query: DUF1315 [M=82] Accession: PF07023.17 Description: Protein of unknown function (DUF1315) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-31 92.6 0.1 7.3e-31 92.5 0.1 1.0 1 WP_007920905.1 Domain annotation for each sequence (and alignments): >> WP_007920905.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.5 0.1 7.3e-31 7.3e-31 2 62 .. 6 66 .. 5 77 .. 0.92 Alignments for each domain: == domain 1 score: 92.5 bits; conditional E-value: 7.3e-31 DUF1315 2 qllasltpdvyqklkrAvEiGkWpdGsrlTeeQRelcmqAViiyeakhlpeeervGyikrk 62 ++++++tpd+yq+lk AvEiGkW dG++lT+eQRel++qA i++e ++lpee+r+Gy+ + WP_007920905.1 6 EMIENITPDIYQSLKLAVEIGKWSDGRKLTAEQRELSLQAMIAWEMQNLPEEQRTGYMGPQ 66 79*******************************************************9654 PP
Or compare WP_007920905.1 to CDD or PaperBLAST