WP_007955624.1 has 222 amino acids
Query: DUF2170 [M=137] Accession: PF09938.13 Description: Uncharacterized protein conserved in bacteria (DUF2170) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-48 150.4 0.3 1.8e-48 150.0 0.3 1.1 1 WP_007955624.1 Domain annotation for each sequence (and alignments): >> WP_007955624.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.0 0.3 1.8e-48 1.8e-48 1 137 [] 84 221 .. 84 221 .. 0.99 Alignments for each domain: == domain 1 score: 150.0 bits; conditional E-value: 1.8e-48 DUF2170 1 awtleelaeaLaeaeevqedeaevevvegeeevLlvtlkeygdLpifvavsgeqilvealLveedevkdraelneelLrtqklfPLssvgiekv. 94 +w++ +l +a+++ +ev+++e+++++++ +e++L ++++e+g+Lpi++a+ g+qi+v+++Lv+ d+++d+ ++n+++Lr++++fPLss+gie++ WP_007955624.1 84 NWNIDSLYNAFKALDEVASQEITLSLIQSSEPSLKLEMNEFGGLPIHIALAGQQIIVDTVLVDIDSITDVRAFNDAVLRSREMFPLSSIGIETMp 178 6********************************************************************************************** PP DUF2170 95 dgedyYvlfGaLsakSslediveEietLadnvidaaealeeyl 137 +g+ +Y +fGaLsa Ssl+++v E++tL+dnv +a ea+e+++ WP_007955624.1 179 NGQTVYNMFGALSADSSLTNVVTEVKTLVDNVQRASEAFEHFF 221 ****************************************986 PP
Or compare WP_007955624.1 to CDD or PaperBLAST