PaperBLAST – Find papers about a protein or its homologs

 

Align WP_008171689.1 to PF06073 (DUF934)

WP_008171689.1 has 168 amino acids

Query:       DUF934  [M=107]
Accession:   PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      3e-44  135.5   0.0    3.7e-44  135.2   0.0    1.1  1  WP_008171689.1  


Domain annotation for each sequence (and alignments):
>> WP_008171689.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  135.2   0.0   3.7e-44   3.7e-44       1     107 []      57     163 ..      57     163 .. 0.99

  Alignments for each domain:
  == domain 1  score: 135.2 bits;  conditional E-value: 3.7e-44
          DUF934   1 gvllasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsva 95 
                     gv+++s++++e l  ++++l++ia++fpkF DGRgyS++rlLRer+gyk+elrA+Gdvl Dql+++krcGfda++lr+dkd+++a++ l+ fs+ 
  WP_008171689.1  57 GVWFDSHDEPEILDGRVNELPVIAVNFPKFSDGRGYSIGRLLRERFGYKNELRAIGDVLLDQLQFMKRCGFDAYVLRADKDINKAARCLNFFSQG 151
                     8********************************************************************************************** PP

          DUF934  96 Yqaavdeeqplf 107
                     Yqaa+d+e plf
  WP_008171689.1 152 YQAATDTEIPLF 163
                     *******99987 PP



Or compare WP_008171689.1 to CDD or PaperBLAST