PaperBLAST – Find papers about a protein or its homologs

 

Align WP_008763492.1 to PF10678 (DUF2492)

WP_008763492.1 has 77 amino acids

Query:       DUF2492  [M=77]
Accession:   PF10678.13
Description: Protein of unknown function (DUF2492)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.5e-35  106.1   0.3      5e-35  106.0   0.3    1.0  1  WP_008763492.1  


Domain annotation for each sequence (and alignments):
>> WP_008763492.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  106.0   0.3     5e-35     5e-35       2      77 .]       3      76 ..       2      76 .. 0.98

  Alignments for each domain:
  == domain 1  score: 106.0 bits;  conditional E-value: 5e-35
         DUF2492  2 siHgHevlelllasgesltrasLkeaieekFGeearFhtCsaedltaeeLiefLlkkgKfiesedglttnaekiCn 77
                    ++H+Hevl+++  +g+s+t+asL++ai ekFGe++rF+tCsa++++++eLi fL++kgKf+++ + +t++ +k+C+
  WP_008763492.1  3 QLHAHEVLHMM--EGNSYTEASLRAAIVEKFGEHQRFYTCSADNMEVDELIGFLKRKGKFMPAGEEFTVDISKVCS 76
                    89*********..**************************************************************6 PP



Or compare WP_008763492.1 to CDD or PaperBLAST