WP_009314825.1 has 282 amino acids
Query: DUF4123 [M=119] Accession: PF13503.11 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-26 78.1 2.2 3.4e-26 78.1 2.2 1.7 2 WP_009314825.1 Domain annotation for each sequence (and alignments): >> WP_009314825.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 78.1 2.2 3.4e-26 3.4e-26 1 118 [. 18 138 .. 18 139 .. 0.83 2 ? -2.0 0.2 0.21 0.21 66 66 .. 229 229 .. 187 271 .. 0.64 Alignments for each domain: == domain 1 score: 78.1 bits; conditional E-value: 3.4e-26 DUF4123 1 lYallDg.aldpellellealsgeaase.LyagtpeeelaevgPwLveleda..sallr.eeegwgpslgwllaSal..plealaahlrsllqvr 88 lY++lD + +e ++lle ++++ Ly gtp+++la++gP+L++l+ + +++ +++ ++++gw laS+ +le+la+h+r +l v+ WP_009314825.1 18 LYLVLDSdGQLDERDALLEGREPHQY-GnLYSGTPASSLAAIGPYLFRLDALdhP-VIQaLLKSPERHWGW-LASSVssDLESLARHWRTRL-VT 108 7******6666666666666666555.45*********************99742.344689*********.5555435999**********.55 PP DUF4123 89 lpdgeevllRfydprvlrallqtldeeqrs 118 +++ +++l Rf+d+rvl + l++l +eqr WP_009314825.1 109 GERPNQALYRFHDSRVLGRALAHLQPEQRP 138 56**************************95 PP == domain 2 score: -2.0 bits; conditional E-value: 0.21 DUF4123 66 w 66 w WP_009314825.1 229 W 229 2 PP
Or compare WP_009314825.1 to CDD or PaperBLAST