WP_009330254.1 has 631 amino acids
Query: DUF2207 [M=172] Accession: PF09972.14 Description: Predicted membrane protein (DUF2207) N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-29 89.5 0.3 2.1e-29 89.1 0.3 1.2 1 WP_009330254.1 Domain annotation for each sequence (and alignments): >> WP_009330254.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.1 0.3 2.1e-29 2.1e-29 1 172 [] 27 203 .. 27 203 .. 0.81 Alignments for each domain: == domain 1 score: 89.1 bits; conditional E-value: 2.1e-29 DUF2207 1 sIerydvdltvqedGslkVtEtitydfdgsyrgiyrdrdlvtryeevdgsensyrvkv.................lddgsepyskessgdvtlsa 78 sIer+d+ +tv+e+G+l+V+E ++ydf+gs++g + r++ +ee++ + ++ + + ++dg++ +++s++++ WP_009330254.1 27 SIERADIRATVKENGDLSVEEVYRYDFKGSFEGAT--RSF---SEETASRLKNFKAYLlpdhrrkggqaiplktkKEDGTYFAYSASKDET---- 112 69*********************************..999...344444444444444566664444444455576666644444444444.... PP DUF2207 79 gevtvtisYtlknavkvykdvaeLywkvigngwdvpienvtitvtlPsakngeeleawlhpldgktkvkkkdgsvtfttrnlpageglevrvlf 172 +v ++Y +++a+++++d++ L + ++ ++++++v+i+v+lP+++++++++a+l+ +++ + +k +d+svt++t+ ++ag+g e+r++f WP_009330254.1 113 --KNVMFRYVIEDAAQKFEDTSILIH-SFYQKANTDFGRVKIEVRLPDSVKARDIHAFLREKGNGKITKVNDSSVTYETGLYRAGTGSELRIYF 203 ..7*******************8877.5555577***************************9999999************************98 PP
Or compare WP_009330254.1 to CDD or PaperBLAST