WP_009330254.1 has 631 amino acids
Query: DUF2207 [M=172] Accession: PF09972.13 Description: Predicted membrane protein (DUF2207) N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-29 88.6 0.4 4.1e-29 88.2 0.4 1.2 1 WP_009330254.1 Domain annotation for each sequence (and alignments): >> WP_009330254.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.2 0.4 4.1e-29 4.1e-29 1 172 [] 27 203 .. 27 203 .. 0.80 Alignments for each domain: == domain 1 score: 88.2 bits; conditional E-value: 4.1e-29 DUF2207 1 sIerydvdvtvqedGsldVtEtitydfdgsrhgiyrkrdlvtrykdvdgssnsyrvkv.................lddgtepyskessgdgtlss 78 sIer+d+ +tv+e+G+l+V+E ++ydf+gs++g + r++ +++++ + ++ + + ++dgt+ ++ s++++ WP_009330254.1 27 SIERADIRATVKENGDLSVEEVYRYDFKGSFEGAT--RSF---SEETASRLKNFKAYLlpdhrrkggqaiplktkKEDGTYFAYSASKDET---- 112 69*********************************..888...344444444433333566664333334444455555544444444444.... PP DUF2207 79 gtvtytisYtvknavtkyndvaeLywkvigngwdvpienvtititlPeaknkgeleawlhpldgkttvkkkdgsvtfttrnlpageglevrvlf 172 +++ ++Y +++a++k++d++ L + ++ ++++++v+i+++lP+++++ +++a+l ++++++++k +d+svt++t+ ++ag+g e+r++f WP_009330254.1 113 --KNVMFRYVIEDAAQKFEDTSILIH-SFYQKANTDFGRVKIEVRLPDSVKARDIHAFLREKGNGKITKVNDSSVTYETGLYRAGTGSELRIYF 203 ..7*******************8877.5557788**********************************************************98 PP
Or compare WP_009330254.1 to CDD or PaperBLAST