WP_009895825.1 has 214 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.8e-22 64.3 0.2 6.9e-22 63.5 0.2 1.5 1 WP_009895825.1
Domain annotation for each sequence (and alignments):
>> WP_009895825.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 63.5 0.2 6.9e-22 6.9e-22 1 55 [. 139 193 .. 139 194 .. 0.98
Alignments for each domain:
== domain 1 score: 63.5 bits; conditional E-value: 6.9e-22
DUF1949 1 ltcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsG 55
+++dY+qlgk+q++L + g+ i+d+ Y d+V+++v+ + e+ve ++++++++tsG
WP_009895825.1 139 VKIDYTQLGKVQNELMNLGYFIKDTVYEDNVEIVVYSRLEDVEKLSEKMIDITSG 193
689***************************************************9 PP
Or compare WP_009895825.1 to CDD or PaperBLAST