WP_010210594.1 has 102 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.1e-23 66.8 0.0 1.1e-22 66.6 0.0 1.0 1 WP_010210594.1
Domain annotation for each sequence (and alignments):
>> WP_010210594.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.6 0.0 1.1e-22 1.1e-22 1 78 [. 14 90 .. 14 91 .. 0.97
Alignments for each domain:
== domain 1 score: 66.6 bits; conditional E-value: 1.1e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+ Id++D+++++ l Rm+++k++ ++K ++ ++ peR++++l ++r++a++ gld e++e +f++ii++ +a Q
WP_010210594.1 14 RQAIDSLDQQIIDALGLRMQYVKAASAFKPDQA-SIAAPERVAAMLPQRRQWAQAVGLDGEFIEGLFNQIIHWYIAEQ 90
99***************************7666.9****************************************999 PP
Or compare WP_010210594.1 to CDD or PaperBLAST