PaperBLAST – Find papers about a protein or its homologs

 

Align WP_010845412.1 to PF06722 (EryCIII-like_C)

WP_010845412.1 has 428 amino acids

Query:       EryCIII-like_C  [M=145]
Accession:   PF06722.16
Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.4e-17   50.1   0.0    2.3e-17   49.4   0.0    1.4  1  WP_010845412.1  


Domain annotation for each sequence (and alignments):
>> WP_010845412.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   49.4   0.0   2.3e-17   2.3e-17      27     132 ..     305     410 ..     279     423 .. 0.83

  Alignments for each domain:
  == domain 1  score: 49.4 bits;  conditional E-value: 2.3e-17
  EryCIII-like_C  27 relpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivlskdeltsdsiakavaevvedpayraa 121
                     +++pdn R+v+++ ++  lp ++ ++ +gG gs+ +a+ +GvP vv + +  +     rv    +gi+l +d+   +++ +av++++  p +r++
  WP_010845412.1 305 EDIPDNARVVEYLNFEHWLPRASIFITNGGYGSLNSAIRHGVPLVVAGTGDGKLEAVARVIWSRCGISLHTDTPSEQQLYQAVTKILSSPIWRQQ 399
                     479****************************************999999866655556777888******************************* PP

  EryCIII-like_C 122 aaklaeeiaae 132
                     a+ ++++  ++
  WP_010845412.1 400 AQIIRADYESH 410
                     *****998766 PP



Or compare WP_010845412.1 to CDD or PaperBLAST