PaperBLAST – Find papers about a protein or its homologs

 

Align WP_010930294.1 to PF11738 (DUF3298)

WP_010930294.1 has 275 amino acids

Query:       DUF3298  [M=83]
Accession:   PF11738.12
Description: Protein of unknown function (DUF3298)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.6e-18   53.8   0.0    1.7e-17   50.5   0.0    2.1  2  WP_010930294.1  


Domain annotation for each sequence (and alignments):
>> WP_010930294.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0     0.048     0.048      11      30 ..      87     106 ..      84     137 .. 0.65
   2 !   50.5   0.0   1.7e-17   1.7e-17      15      83 .]     194     261 ..     182     261 .. 0.82

  Alignments for each domain:
  == domain 1  score: 1.0 bits;  conditional E-value: 0.048
         DUF3298  11 lealselikkqlkkqaeeqe 30 
                     ++alsel+ +ql++++  ++
  WP_010930294.1  87 IPALSELVDRQLAAMTGVDQ 106
                     68999*******99995444 PP

  == domain 2  score: 50.5 bits;  conditional E-value: 1.7e-17
         DUF3298  15 selikkqlkkqaeeqeleeyeeleeefdaddisaydnFyltddglvfyfnpYeiaPyaaGaieftiPys 83 
                       +++++++++ +++e+++ +      + + +++++nF+lt +glv+ ++ Y iaPy+ G++e+ iPy+
  WP_010930294.1 194 VVAMREAHQRWLAANEDAQHDRAAY-DRMWPFQETTNFALTRQGLVVKYDAYTIAPYSHGQPEILIPYE 261
                     4567788888888777665555555.69****************************************7 PP



Or compare WP_010930294.1 to CDD or PaperBLAST