WP_011071575.1 has 671 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.4e-22 63.9 2.3 1.6e-21 62.8 2.3 1.6 1 WP_011071575.1
Domain annotation for each sequence (and alignments):
>> WP_011071575.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.8 2.3 1.6e-21 1.6e-21 1 79 [] 11 89 .. 11 89 .. 0.96
Alignments for each domain:
== domain 1 score: 62.8 bits; conditional E-value: 1.6e-21
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R++I ++D++ll LlaeR +l+ e+a+ K+ p++d++Re+e+l+rl +e+gld+++v ++++ ii+ s+ Q+
WP_011071575.1 11 REQITQLDNDLLSLLAERRRLSLEVARSKEVDVRPIRDTQREKELLARLVTAGREKGLDAHYVISLYQSIIEDSVLNQQ 89
9****************************77777*****************999********************98885 PP
Or compare WP_011071575.1 to CDD or PaperBLAST