WP_011081756.1 has 109 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.4e-24 71.9 0.1 3e-24 71.5 0.1 1.1 1 WP_011081756.1
Domain annotation for each sequence (and alignments):
>> WP_011081756.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.5 0.1 3e-24 3e-24 1 78 [. 17 93 .. 17 94 .. 0.95
Alignments for each domain:
== domain 1 score: 71.5 bits; conditional E-value: 3e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R Id +D+e++++l++Rm ++k++a++K ++ +++ peR++ +le++r +a+e+gl++e+ve++f++ii++ +++Q
WP_011081756.1 17 RLGIDTLDKEIVHILSQRMGYVKAAAQFKPDE-KSIPAPERVASMLEERRHWANEQGLSEEYVEALFDNIIQWYISQQ 93
667**************************655.59****************************************998 PP
Or compare WP_011081756.1 to CDD or PaperBLAST