WP_011159102.1 has 283 amino acids
Query: UPF0020 [M=197]
Accession: PF01170.22
Description: Putative RNA methylase family UPF0020
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-09 24.3 0.0 2e-09 23.5 0.0 1.3 1 WP_011159102.1
Domain annotation for each sequence (and alignments):
>> WP_011159102.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 23.5 0.0 2e-09 2e-09 76 128 .. 102 153 .. 91 154 .. 0.89
Alignments for each domain:
== domain 1 score: 23.5 bits; conditional E-value: 2e-09
UPF0020 76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
+ k yg+D+ ++++ ar+N +kag++ +ef + ++ +++l++++vdvi++n
WP_011159102.1 102 TGKAYGLDMTDEMLALARDNQRKAGLD-NVEFLKGEIEAIPLPDHSVDVIISN 153
5578*********************95.6899999******99*********9 PP
Or compare WP_011159102.1 to CDD or PaperBLAST