PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011159102.1 to PF01170 (UPF0020)

WP_011159102.1 has 283 amino acids

Query:       UPF0020  [M=197]
Accession:   PF01170.24
Description: RMKL-like, methyltransferase domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-09   24.3   0.0      2e-09   23.5   0.0    1.3  1  WP_011159102.1  


Domain annotation for each sequence (and alignments):
>> WP_011159102.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.5   0.0     2e-09     2e-09      76     128 ..     102     153 ..      91     154 .. 0.89

  Alignments for each domain:
  == domain 1  score: 23.5 bits;  conditional E-value: 2e-09
         UPF0020  76 elklygsDldrrvvqgareNaekagvgdliefsqadaakLrlkegevdvivtn 128
                     + k yg+D+  ++++ ar+N +kag++  +ef + ++ +++l++++vdvi++n
  WP_011159102.1 102 TGKAYGLDMTDEMLALARDNQRKAGLD-NVEFLKGEIEAIPLPDHSVDVIISN 153
                     5578*********************95.6899999******99*********9 PP



Or compare WP_011159102.1 to CDD or PaperBLAST