WP_011402490.1 has 110 amino acids
Query: UPF0060 [M=107]
Accession: PF02694.19
Description: Uncharacterised BCR, YnfA/UPF0060 family
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.7e-39 120.7 8.0 1.9e-39 120.5 8.0 1.0 1 WP_011402490.1
Domain annotation for each sequence (and alignments):
>> WP_011402490.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 120.5 8.0 1.9e-39 1.9e-39 6 107 .] 9 110 .] 4 110 .] 0.97
Alignments for each domain:
== domain 1 score: 120.5 bits; conditional E-value: 1.9e-39
UPF0060 6 llfllaalaeigGaylvwlwlreaksvllalvaaillavygflatlqpaafGrvyaayGGvfvvlallwglvvdgvkldlydwiGalialvGvlv 100
lf+l+a+aei+G+yl+wl l+ +k+v+l+ +aa++la++++l+tl+paa r yaayGGv++++al+w+++vdgv l ++d Ga+ al+G+ v
WP_011402490.1 9 ALFVLTAVAEIVGCYLPWLVLKAGKPVWLLAPAALSLALFAWLLTLHPAAAARTYAAYGGVYIAVALAWLRIVDGVPLSRWDAAGAALALAGMSV 103
69********************************************************************************************* PP
UPF0060 101 ilyaprg 107
i prg
WP_011402490.1 104 IALQPRG 110
*999886 PP
Or compare WP_011402490.1 to CDD or PaperBLAST