WP_011407578.1 has 189 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.9e-15 42.8 0.3 9.6e-15 41.1 0.0 1.8 2 WP_011407578.1
Domain annotation for each sequence (and alignments):
>> WP_011407578.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 41.1 0.0 9.6e-15 9.6e-15 11 79 .] 37 105 .. 35 105 .. 0.96
2 ? -1.0 0.1 0.13 0.13 1 16 [. 129 144 .. 129 148 .. 0.90
Alignments for each domain:
== domain 1 score: 41.1 bits; conditional E-value: 9.6e-15
CM_2 11 lleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
l++ + +R ++ +++a K ++g+pvld++Re++vl+r+r++a ++gld++ ++++f + i++ +++Q+
WP_011407578.1 37 LMDRIVQRNAIGDAVALSKWDSGKPVLDQAREAAVLQRVRDQAPAHGLDADDAARFFGQQIEANKSVQY 105
678899***********************************************************9996 PP
== domain 2 score: -1.0 bits; conditional E-value: 0.13
CM_2 1 RkeIdeiDrelleLla 16
R+++d++ ell+ la
WP_011407578.1 129 RTRLDQLQGELLDALA 144
8999********9997 PP
Or compare WP_011407578.1 to CDD or PaperBLAST