WP_011477984.1 has 218 amino acids
Query: DUF374 [M=69]
Accession: PF04028.17
Description: Domain of unknown function (DUF374)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-26 77.6 0.0 3.5e-26 77.0 0.0 1.3 1 WP_011477984.1
Domain annotation for each sequence (and alignments):
>> WP_011477984.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 77.0 0.0 3.5e-26 3.5e-26 6 68 .. 75 137 .. 70 138 .. 0.96
Alignments for each domain:
== domain 1 score: 77.0 bits; conditional E-value: 3.5e-26
DUF374 6 kkiaaliSrsrDGeliarvlerlgiktvrGSssrggaralremlralkeGesiaiTpDGPrGP 68
+ ++aliS + DG+++++++ ++g+k++ GSs+++ alr+++++l +G +++iTpDGP+GP
WP_011477984.1 75 PDVYALISPHLDGKILNDLVDKFGCKVIVGSSNKNPLGALRNIIEKLSQGANVIITPDGPKGP 137
5799*********************************************************** PP
Or compare WP_011477984.1 to CDD or PaperBLAST