WP_011516462.1 has 66 amino acids
Query: DUF1289 [M=48]
Accession: PF06945.17
Description: Protein of unknown function (DUF1289)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1e-21 62.9 0.6 1.2e-21 62.7 0.6 1.1 1 WP_011516462.1
Domain annotation for each sequence (and alignments):
>> WP_011516462.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 62.7 0.6 1.2e-21 1.2e-21 1 47 [. 5 51 .. 5 52 .. 0.97
Alignments for each domain:
== domain 1 score: 62.7 bits; conditional E-value: 1.2e-21
DUF1289 1 sPCigvCkldaedgvCrGCgRtldEiaaWsrmsdeerravlarlaer 47
+PCi++C++d + ++C+GC+Rt Ei W +m++ +r +vla l+ r
WP_011516462.1 5 NPCINICRMDLAGKYCQGCRRTTVEIGLWDTMTEVQRIEVLADLPLR 51
6*******************************************998 PP
Or compare WP_011516462.1 to CDD or PaperBLAST