WP_011704269.1 has 157 amino acids
Query: DUF494 [M=153] Accession: PF04361.17 Description: Protein of unknown function (DUF494) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-66 208.4 3.0 2.7e-66 208.3 3.0 1.0 1 WP_011704269.1 Domain annotation for each sequence (and alignments): >> WP_011704269.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 208.3 3.0 2.7e-66 2.7e-66 1 153 [] 1 157 [] 1 157 [] 0.98 Alignments for each domain: == domain 1 score: 208.3 bits; conditional E-value: 2.7e-66 DUF494 1 mfdvLvYLfenyi..eaealpdedeLeeeLsaaGFeeeeIkkAldwleeLaalqeeeeeaal..aessslRiyteeEqekLdaeargfllfLeqa 91 mfdvL+YLfe+yi +a+++++++eL++eLs+aGF+++eI+kAl+wle+La+l+++e+e ++ +++ s+Riy+++E+++L++e+rgfllfLeqa WP_011704269.1 1 MFDVLMYLFETYIhsDADVMVEQNELTDELSRAGFDKDEIEKALNWLERLANLHDSEREVYVaaSAQGSMRIYAPQELARLSTECRGFLLFLEQA 95 9************99999****************************************9998889999*************************** PP DUF494 92 gvldaetrElvidramaldeeeisledlkwvvlmvlfnqpgeekallileellldeeeellh 153 +vl+aetrE+ i+r+++ld+ +i+l+dlkwvv+mvlfn pg+e+a++++eel++de+++++h WP_011704269.1 96 QVLNAETREICIERLLELDKPDIELDDLKWVVMMVLFNVPGSENAYQQMEELVFDESDGVIH 157 **********************************************************9998 PP
Or compare WP_011704269.1 to CDD or PaperBLAST