WP_012074312.1 has 162 amino acids
Query: DUF934 [M=107]
Accession: PF06073.16
Description: Bacterial protein of unknown function (DUF934)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-41 126.4 0.0 2.6e-41 126.1 0.0 1.1 1 WP_012074312.1
Domain annotation for each sequence (and alignments):
>> WP_012074312.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.1 0.0 2.6e-41 2.6e-41 3 107 .] 55 159 .. 53 159 .. 0.99
Alignments for each domain:
== domain 1 score: 126.1 bits; conditional E-value: 2.6e-41
DUF934 3 llasdedveelaadldrlalialefpkFtDGRgySqarlLRerlgykgelrAvGdvlrDqlellkrcGfdafelredkdaeaaekalerfsvaYq 97
+la+d++ve l +++++l+lia++fp+F+DGRgyS+a+lLR rlg++gelrAvGdvlrDql+++++cGfdaf++redk++e+a k l+ +sv Y
WP_012074312.1 55 WLAPDDEVEVLLPYFAELPLIAVDFPSFRDGRGYSLAYLLRVRLGWSGELRAVGDVLRDQLSHMRQCGFDAFAVREDKNVEDALKGLAGLSVLYG 149
89********************************************************************************************* PP
DUF934 98 aavdeeqplf 107
+++ e++plf
WP_012074312.1 150 RSAIEPRPLF 159
********98 PP
Or compare WP_012074312.1 to CDD or PaperBLAST