WP_012081926.1 has 1148 amino acids
Query: Met_synt_B12 [M=273] Accession: PF02965.22 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-34 105.1 0.0 4.5e-34 104.2 0.0 1.4 1 WP_012081926.1 Domain annotation for each sequence (and alignments): >> WP_012081926.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.2 0.0 4.5e-34 4.5e-34 56 257 .. 941 1148 .] 895 1148 .] 0.81 Alignments for each domain: == domain 1 score: 104.2 bits; conditional E-value: 4.5e-34 Met_synt_B12 56 llkakavvglfpansvgddievy.......adesrse........elatlhtLrqqaekeegepnlclaDfvapkesgvkDyiGlfavtaglg 133 ++ ++g +pa++v++++ v+ +de+ ++ + ++ t +q ++ p++c+aD+ +++ + D+ ++ +v+ag WP_012081926.1 941 IFEPTILYGYWPARAVDNELYVFgeefgwqRDEDANRepieniigDAIEIFTFPRQ----SKPPHRCIADYFHDE---RMDVSAFTCVSAGNR 1026 56777889999999999999999666666522222223343333323333333333....46799*******995...56999999******* PP Met_synt_B12 134 ieelakefeaeeDdYsailvkalaDrLaeAfaellhekvrkelWgyakdeklsneelikekYqGiRpApGYpacpdhsekktlfelldaeeki 226 +e+ e+ ++ ++ lv+ l+ LaeA+ae h+++r e g ++ek + ++ YqG R++pGYpacpd + ++++f+ll+ ee WP_012081926.1 1027 FSEYEGELFKAGKYHEYHLVHGLSVELAEALAEIAHKQIRIE-LGILRNEKPDLGDVKMVGYQGARYSPGYPACPDLELNRHIFNLLQPEE-F 1117 *****99988877777789**********************9.6999*******************************************9.* PP Met_synt_B12 227 gieLteslamtPaasvsGlyfahpeskyFav 257 gi+L+e++ ++P++s +++++ hpe+kyF++ WP_012081926.1 1118 GITLSETFQIHPEQSTCAIVVHHPEAKYFNI 1148 *****************************96 PP
Or compare WP_012081926.1 to CDD or PaperBLAST