WP_012549517.1 has 106 amino acids
Query: DUF446 [M=98]
Accession: PF04287.16
Description: tRNA pseudouridine synthase C
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.9e-37 112.6 0.1 4.3e-37 112.4 0.1 1.0 1 WP_012549517.1
Domain annotation for each sequence (and alignments):
>> WP_012549517.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 112.4 0.1 4.3e-37 4.3e-37 3 98 .] 8 102 .. 6 102 .. 0.97
Alignments for each domain:
== domain 1 score: 112.4 bits; conditional E-value: 4.3e-37
DUF446 3 aelLeeleaeLrelelWqeeapseealastePFavdtlefeeWLqwvfiprmkalieaeqpLPkavaiapmaeealkeeeeekeellallkelDe 97
+ lL++l ++L+++++Wq+++ps +alastePFa+dtl+ +eWLqw+fip+m lie+++pLPk ++iap++eealk+++ ++e++ +++++D+
WP_012549517.1 8 TVLLKQLTEQLQHHGHWQTATPSLSALASTEPFAIDTLSSTEWLQWIFIPKMFILIENGHPLPKGFSIAPYIEEALKNQKG-TTEIIGICQNIDK 101
5689***************************************************************************99.9***********8 PP
DUF446 98 l 98
l
WP_012549517.1 102 L 102
6 PP
Or compare WP_012549517.1 to CDD or PaperBLAST