WP_013161200.1 has 64 amino acids
Query: DUF3046 [M=62]
Accession: PF11248.12
Description: Protein of unknown function (DUF3046)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-29 89.0 1.0 1.2e-29 88.8 1.0 1.0 1 WP_013161200.1
Domain annotation for each sequence (and alignments):
>> WP_013161200.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.8 1.0 1.2e-29 1.2e-29 1 61 [. 1 61 [. 1 62 [. 0.99
Alignments for each domain:
== domain 1 score: 88.8 bits; conditional E-value: 1.2e-29
DUF3046 1 MRlteFwelveeeFGsayaeslardhvlselggrTaeeAleaGvdprdVWralcdafdvPe 61
MR+teFw+++++++G +ya+++a+++vlsel++rT++eAl++Gv+++ Wra+++ +++Pe
WP_013161200.1 1 MRETEFWRRMDHHLGGNYARVWADQIVLSELDNRTVREALDDGVPFKVAWRAVWKFLELPE 61
************************************************************9 PP
Or compare WP_013161200.1 to CDD or PaperBLAST