WP_014114093.1 has 405 amino acids
Query: EryCIII-like_C [M=145] Accession: PF06722.16 Description: Erythromycin biosynthesis protein CIII-like, C-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-21 62.5 0.0 3.1e-21 62.0 0.0 1.3 1 WP_014114093.1 Domain annotation for each sequence (and alignments): >> WP_014114093.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.0 0.0 3.1e-21 3.1e-21 3 127 .. 252 377 .. 250 394 .. 0.92 Alignments for each domain: == domain 1 score: 62.0 bits; conditional E-value: 3.1e-21 EryCIII-like_C 3 vldqvaelDaEivvalded.arpdlrelpdnvRlvdfvPlgvllptcaaivHhgGagstltalsfGvPqvvlpdeadaavrarrvaelGagivls 96 l+ ++D+ +v+++ ++ ++++l+++p+n + +vP +l+ ++ +v hgG st +l f P vv+p +ad+++ +++v ++Gag vl+ WP_014114093.1 252 CLEVCKDFDGKVVLSIGKHiKANELNDIPENFIVRPYVPQLEILKRASLFVTHGGMNSTSEGLYFETPLVVIPMGADQFAVGNQVEKIGAGKVLK 346 5777889*********87637899*******8888************************************************************ PP EryCIII-like_C 97 kdeltsdsiakavaevvedpayraaaaklae 127 k++l + ++++++ev+++p y + a+ + + WP_014114093.1 347 KEQLSESLLKETIQEVMNNPVYAKKAKDIGQ 377 ***********************99998766 PP
Or compare WP_014114093.1 to CDD or PaperBLAST