WP_014261721.1 has 168 amino acids
Query: DUF1877 [M=163] Accession: PF08974.14 Description: Domain of unknown function (DUF1877) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-53 165.1 6.3 8.6e-53 164.9 6.3 1.0 1 WP_014261721.1 Domain annotation for each sequence (and alignments): >> WP_014261721.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 164.9 6.3 8.6e-53 8.6e-53 1 163 [] 1 166 [. 1 166 [. 0.98 Alignments for each domain: == domain 1 score: 164.9 bits; conditional E-value: 8.6e-53 DUF1877 1 Mgmlgnylrlteeelekllkdped...ledfleeeeeeeeleelaediDKaWdaLhflltgds.....genplsevvlGgeplgedegygparll 87 Mg ++ny++l++e+l++l+++++ l++++ee++ee+++ diDK+Wd+Lhf+ltg + +++plse+v+G++ + ++ + ++ ++ WP_014261721.1 1 MGLIANYQYLSDENLKELKEFSGSeddLMEQVEEWNEEADILL---DIDKMWDVLHFVLTGVDssepiENDPLSEAVVGVSVM--EGIENFIAYT 90 ********************9887778**************87...****************99*******************..9********* PP DUF1877 88 tpeqVkeiaeaLaaldfeelrekfdaeelkeaeiYpniwdeeeeededleyllsyfeeLkeFykkaakegkavlvt 163 ++++V+++ +aL+++d+e+++++f++e++k+a++Ypniwd+eeeede++e++++yfe++ +Fy+k+++++ +vlvt WP_014261721.1 91 DKSKVADVLSALEDFDIESAMDEFSMEDCKKADLYPNIWDYEEEEDEIKEEITDYFEAMINFYRKILETNGNVLVT 166 **************************************************************************96 PP
Or compare WP_014261721.1 to CDD or PaperBLAST