WP_014355324.1 has 205 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.13
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.2e-32 96.9 8.2 2.2e-32 96.9 8.2 1.6 2 WP_014355324.1
Domain annotation for each sequence (and alignments):
>> WP_014355324.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.0 0.0 0.34 0.34 16 27 .. 19 30 .. 9 34 .. 0.70
2 ! 96.9 8.2 2.2e-32 2.2e-32 3 89 .. 107 193 .. 105 199 .. 0.91
Alignments for each domain:
== domain 1 score: -3.0 bits; conditional E-value: 0.34
DUF5981 16 kvleekCkaCge 27
kv+ +C+ C e
WP_014355324.1 19 KVVIINCHGCKE 30
556667888865 PP
== domain 2 score: 96.9 bits; conditional E-value: 2.2e-32
DUF5981 3 avntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevepekeCawvliyerlkklgrleklekiv 89
++t l + + v+ l+ +C +CgeC+l+ tggiCp+t+C+ksl+nG+CgG+kng+Cev++++eC w++iy++l+kl++l++++ +
WP_014355324.1 107 CCDTYQLPGFQGVTPLNVDCGQCGECYLNGTGGICPITACSKSLINGQCGGAKNGMCEVDKDMECGWERIYRKLEKLNKLDNMKYDA 193
56777778888899999*****************************************************************96544 PP
Or compare WP_014355324.1 to CDD or PaperBLAST