WP_014355324.1 has 205 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.2e-32 96.4 8.3 3.2e-32 96.4 8.3 1.6 2 WP_014355324.1
Domain annotation for each sequence (and alignments):
>> WP_014355324.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -3.0 0.0 0.32 0.32 16 27 .. 19 30 .. 9 34 .. 0.71
2 ! 96.4 8.3 3.2e-32 3.2e-32 4 88 .. 108 192 .. 105 199 .. 0.90
Alignments for each domain:
== domain 1 score: -3.0 bits; conditional E-value: 0.32
DUF5981 16 kvleekCkaCge 27
kv+ +C+ C e
WP_014355324.1 19 KVVIINCHGCKE 30
566677888865 PP
== domain 2 score: 96.4 bits; conditional E-value: 3.2e-32
DUF5981 4 vntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevkpekeCawvliyerlkklgrlekleki 88
++t l + v+ l+ +C +CgeC+l+ tggiCp+t+C+ksl+nG+CgG+kng+Cev++++eC w++iy++l+kl++l++++
WP_014355324.1 108 CDTYQLPGFQGVTPLNVDCGQCGECYLNGTGGICPITACSKSLINGQCGGAKNGMCEVDKDMECGWERIYRKLEKLNKLDNMKYD 192
66777777788889999***************************************************************99654 PP
Or compare WP_014355324.1 to CDD or PaperBLAST