WP_014514508.1 has 116 amino acids
Query: DUF6285 [M=91]
Accession: PF19802.3
Description: Domain of unknown function (DUF6285)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.9e-25 73.8 1.0 1.1e-24 73.3 1.0 1.2 1 WP_014514508.1
Domain annotation for each sequence (and alignments):
>> WP_014514508.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 73.3 1.0 1.1e-24 1.1e-24 4 90 .. 27 110 .. 23 111 .. 0.95
Alignments for each domain:
== domain 1 score: 73.3 bits; conditional E-value: 1.1e-24
DUF6285 4 egraaFharVaaNalaiveRelalgpaaaaaerarlaallgedgdlealnaeLaaaIrageldldtpallahLratvlakLavdnPk 90
++r++F+a+Va Nal+i++Re+alg+a +a++ +l +llg++gd e l +eLa++Ir+ge +++++ L+a v++kL+++ Pk
WP_014514508.1 27 DPRLHFQALVALNALGIARREVALGKALEAEDLGELGRLLGREGDREGLLRELAQRIRQGEAP---EGTFSFLKAHVARKLRIASPK 110
789*********************************************************888...58******************8 PP
Or compare WP_014514508.1 to CDD or PaperBLAST