WP_014688675.1 has 116 amino acids
Query: Rv2175c_C [M=56]
Accession: PF18367.5
Description: Rv2175c C-terminal domain of unknown function
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-23 68.1 0.1 4.1e-23 67.6 0.1 1.2 1 WP_014688675.1
Domain annotation for each sequence (and alignments):
>> WP_014688675.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 67.6 0.1 4.1e-23 4.1e-23 2 56 .] 61 115 .. 60 115 .. 0.98
Alignments for each domain:
== domain 1 score: 67.6 bits; conditional E-value: 4.1e-23
Rv2175c_C 2 kgLpGtltvLrDgGfddeeilrWLFteDesLpgrPidALregrkrEVkRrAqalA 56
k+LpG+l vLrD+G++dee+ rWL+ eD+ g+ AL +++rE+kRrAqal+
WP_014688675.1 61 KHLPGVLNVLRDAGYNDEEAFRWLYAEDAEVGGSAAIALGGQQAREIKRRAQALG 115
89***************************************************97 PP
Or compare WP_014688675.1 to CDD or PaperBLAST