WP_014876103.1 has 102 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-23 69.0 0.1 2.4e-23 68.6 0.1 1.1 1 WP_014876103.1
Domain annotation for each sequence (and alignments):
>> WP_014876103.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 68.6 0.1 2.4e-23 2.4e-23 1 77 [. 20 96 .. 20 98 .. 0.98
Alignments for each domain:
== domain 1 score: 68.6 bits; conditional E-value: 2.4e-23
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesral 77
R++Id++D+ l+ l eR++ +++++++K+e++lp dp Re ++++rl++ ae+++ldp++++++++ ii+e +++
WP_014876103.1 20 RESIDRLDAILVYTLGERFKHTQAVGRLKAEHDLPPSDPTRETAQIARLEDLAEQADLDPDFAKAFLNFIIQEVIRH 96
99***********************************************************************9975 PP
Or compare WP_014876103.1 to CDD or PaperBLAST