WP_014936470.1 has 714 amino acids
Query: DUF4132 [M=179] Accession: PF13569.11 Description: Domain of unknown function (DUF4132) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-27 81.0 0.0 1.8e-26 79.3 0.0 1.8 1 WP_014936470.1 Domain annotation for each sequence (and alignments): >> WP_014936470.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.3 0.0 1.8e-26 1.8e-26 2 141 .. 467 606 .. 467 619 .. 0.97 Alignments for each domain: == domain 1 score: 79.3 bits; conditional E-value: 1.8e-26 DUF4132 2 krlkslPaklkkddaelakelkalkkdlreqaarqrarLeramvtgrrwtaeewqellvdhpllghlvrrLvwvve.eegkllrafr..edksla 93 k+lk++P++ ++ +e e+k l+k++++ +++ + L ++++g+ ++++ ++++vd+ ++++++++L+w + ++ k+l++fr d+s+ WP_014936470.1 467 KELKKIPQNFDENLKE---EIKSLRKEVADFIKNTSHLLSVLLIEGKIYSYDFYKDVFVDNTMMNKFASTLIWNLYdKDYKFLTTFRysGDGSYS 558 899*******999998...*********************************************************99999*******99***** PP DUF4132 94 dvddetvelkedaevriaHPleleaeelaawqelladyeivQpfkQlf 141 + +de++++++++ v++a P+e+++e++++w+++l+dye+ Qp++Ql+ WP_014936470.1 559 NFNDEEIKIDNNSFVGLASPVEMDDETISKWRKQLEDYELSQPLEQLS 606 **********************************************95 PP
Or compare WP_014936470.1 to CDD or PaperBLAST