WP_015050598.1 has 223 amino acids
Query: DUF5981 [M=95]
Accession: PF12225.12
Description: Methylene-tetrahydrofolate reductase C terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-42 128.9 2.2 4.7e-42 127.9 2.2 1.5 1 WP_015050598.1
Domain annotation for each sequence (and alignments):
>> WP_015050598.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 127.9 2.2 4.7e-42 4.7e-42 1 94 [. 111 204 .. 111 205 .. 0.99
Alignments for each domain:
== domain 1 score: 127.9 bits; conditional E-value: 4.7e-42
DUF5981 1 ypavntlflgveeevkvleekCkaCgeCvlaetggiCpvtrCpksllnGpCgGskngkCevkpekeCawvliyerlkklgrleklekivppkdw 94
yp+vnt+flg++++++++ee C aCgeCvl++tggiCp++rC+k+llnGpCgGs+ gkCev+++++C w+liyerlk+lg+l+k+++++p+k+w
WP_015050598.1 111 YPGVNTQFLGANRDIGKWEEFCMACGECVLDKTGGICPIARCSKHLLNGPCGGSQYGKCEVSKDVDCGWHLIYERLKALGQLDKMAEFIPAKNW 204
799******************************************************************************************9 PP
Or compare WP_015050598.1 to CDD or PaperBLAST