WP_017211369.1 has 215 amino acids
Query: DUF1949 [M=56]
Accession: PF09186.15
Description: Domain of unknown function (DUF1949)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-18 52.6 1.4 2.2e-18 52.2 0.1 1.8 2 WP_017211369.1
Domain annotation for each sequence (and alignments):
>> WP_017211369.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.0 0.1 0.18 0.18 39 51 .. 31 43 .. 30 44 .. 0.81
2 ! 52.2 0.1 2.2e-18 2.2e-18 2 56 .] 139 193 .. 138 193 .. 0.98
Alignments for each domain:
== domain 1 score: -2.0 bits; conditional E-value: 0.18
DUF1949 39 eeeveafkqaLte 51
eee+ af++++ +
WP_017211369.1 31 EEEAKAFINEIKN 43
6889999999977 PP
== domain 2 score: 52.2 bits; conditional E-value: 2.2e-18
DUF1949 2 tcdYaqlgklqrlLeqfgatildeeYtddVtltvevpeeeveafkqaLteltsGr 56
+++Y+++gk+q+ ++q++++i+d+eY+d+V+ ++ ++ +e +++++ e t+G+
WP_017211369.1 139 EMEYDLFGKVQYTCGQNSWHIEDTEYSDKVVVNILAEKLMAEDIENEIVEVTNGK 193
689***************************************************7 PP
Or compare WP_017211369.1 to CDD or PaperBLAST