WP_018223844.1 has 132 amino acids
Query: DUF1870 [M=118]
Accession: PF08965.14
Description: Domain of unknown function (DUF1870)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4e-10 26.1 0.0 4.7e-10 25.9 0.0 1.1 1 WP_018223844.1
Domain annotation for each sequence (and alignments):
>> WP_018223844.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 25.9 0.0 4.7e-10 4.7e-10 1 96 [. 16 108 .. 16 124 .. 0.80
Alignments for each domain:
== domain 1 score: 25.9 bits; conditional E-value: 4.7e-10
DUF1870 1 mnaveLqalRkilaltieeaatyiaqavdsatWksWesgklaipdeieaelkklkqrrkklleeiveklnerignntlryysdltafltvypegn 95
m e +R+ l+lt + a ++ +v+ t ++We+gk +ipd + +++l r + ++ +vekl + + + +y sd +++ +pe +
WP_018223844.1 16 MTDAEFRVVREHLGLTGDWLAAHL--GVSPRTVRHWEQGKYPIPDGVRLAIEDLERRTAEFVGGVVEKLLDVPDPAVPTYRSD-AEYRAAHPEVE 107
666788889999999998888555..68999***************************************9987666555554.56777777776 PP
DUF1870 96 f 96
f
WP_018223844.1 108 F 108
6 PP
Or compare WP_018223844.1 to CDD or PaperBLAST