WP_018244389.1 has 165 amino acids
Query: DUF892 [M=159] Accession: PF05974.16 Description: Domain of unknown function (DUF892) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-68 215.1 6.4 3.1e-68 215.0 6.4 1.0 1 WP_018244389.1 Domain annotation for each sequence (and alignments): >> WP_018244389.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 215.0 6.4 3.1e-68 3.1e-68 1 158 [. 6 162 .. 6 163 .. 0.99 Alignments for each domain: == domain 1 score: 215.0 bits; conditional E-value: 3.1e-68 DUF892 1 tleelfideLrDayaaEkqalkalpkmakaaespeLkaaleqHleeTeqqierleqvferlgeeasekkcdameglvaegqelleeaiedeevkd 95 tle+lf+d+L+D+y aE+q+l alpkma+aa+speLk+ +e+H eeTe+q+erl+qvfe++g++a++k+c+a++g++aeg+e++ee ++ ++++d WP_018244389.1 6 TLEDLFYDTLKDIYFAERQILRALPKMARAAQSPELKKGFEKHREETEGQVERLQQVFELIGKRAQGKTCEAIQGIIAEGEEIMEE-FKGTSALD 99 799**********************************************************************************9.******** PP DUF892 96 aaliaaaqavehyEiasYgtLialAeqlgeaeaaelLeqtldeEkatdekLtelaeelvnqea 158 a+li+aaqavehyEia+YgtL ++A +lg++e++ lL+qtl++E atd+ L++la++ +nq+a WP_018244389.1 100 AGLISAAQAVEHYEIARYGTLKTWAATLGLKEVVGLLDQTLQQETATDKALSQLATTAANQKA 162 *************************************************************98 PP
Or compare WP_018244389.1 to CDD or PaperBLAST