WP_022470709.1 has 264 amino acids
Query: LiaF-like_C [M=114]
Accession: PF09922.13
Description: Cell wall-active antibiotics response LiaF, C-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.3e-14 39.5 0.0 4e-14 38.8 0.0 1.4 1 WP_022470709.1
Domain annotation for each sequence (and alignments):
>> WP_022470709.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 38.8 0.0 4e-14 4e-14 19 85 .. 180 245 .. 163 253 .. 0.84
Alignments for each domain:
== domain 1 score: 38.8 bits; conditional E-value: 4e-14
LiaF-like_C 19 iqrviGdttiDLskavlpkgetvivirkliGdvkilVPedvevsveasvifGsvtvldekeagllne 85
+ + G ttiDL+ + + get i + G ++i+VP+d++v + +++fG + ++ ++g +n+
WP_022470709.1 180 VRTSCGGTTIDLRHTHIAPGETYIDLDCSWGGIEIYVPSDWKVVFKCNAFFGGCDD-KRWQNGNINK 245
66778***********************************************9993.4334444554 PP
Or compare WP_022470709.1 to CDD or PaperBLAST