WP_022632446.1 has 128 amino acids
Query: DUF3461 [M=125] Accession: PF11944.12 Description: Protein of unknown function (DUF3461) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-59 184.7 2.5 3.7e-59 184.6 2.5 1.0 1 WP_022632446.1 Domain annotation for each sequence (and alignments): >> WP_022632446.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 184.6 2.5 3.7e-59 3.7e-59 1 125 [] 1 125 [. 1 125 [. 1.00 Alignments for each domain: == domain 1 score: 184.6 bits; conditional E-value: 3.7e-59 DUF3461 1 myehLksigitepdeierytLrqeaeadiLkiyfkkekgellaksvkfkfprqrkkilvdsgseeyknvseinatLrqvldeLdkltekekaead 95 my++Lks+gi++p++i+ry+Lrqea++diLkiyf+k+kge++aksvkfk+prqrk+i d+ + yk+++ei+++Lr+v+deLd++ ++++ e+d WP_022632446.1 1 MYDNLKSLGISNPEDIDRYSLRQEASNDILKIYFRKDKGEFFAKSVKFKYPRQRKTIVADNAGQGYKEINEISPNLRYVVDELDQICQRDQVEVD 95 9********************************************************************************************** PP DUF3461 96 ikkklLedlkhlervvqdkikeierdlekl 125 +k+k+L+dl+hle+vv++ki+eie+dlekl WP_022632446.1 96 LKRKILSDLHHLESVVTNKISEIEADLEKL 125 ****************************97 PP
Or compare WP_022632446.1 to CDD or PaperBLAST