PaperBLAST – Find papers about a protein or its homologs

 

Align WP_022632810.1 to PF13503 (DUF4123)

WP_022632810.1 has 322 amino acids

Query:       DUF4123  [M=123]
Accession:   PF13503.10
Description: Domain of unknown function (DUF4123)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-27   82.1   5.3    1.9e-27   82.1   5.3    1.9  2  WP_022632810.1  


Domain annotation for each sequence (and alignments):
>> WP_022632810.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   82.1   5.3   1.9e-27   1.9e-27       1     122 [.      19     145 ..      19     146 .. 0.94
   2 ?   -1.7   0.0      0.18      0.18      65      87 ..     284     306 ..     245     321 .. 0.57

  Alignments for each domain:
  == domain 1  score: 82.1 bits;  conditional E-value: 1.9e-27
         DUF4123   1 lYaLlDgaadpellelleaesgeaase...LyagtpeeelaevgPwLveledasel.sallr.leeegwgpslgl.llaSaapleelarhLrsll 89 
                     lYa++D +++p+l++ ++a++++ a+    L  + +++++++++P++v++e++ +  + ll  l++++++++ g+ l++S+++l ++a+ ++++l
  WP_022632810.1  19 LYAIVDPMRYPALPDFWRAFQPRSAQIwqrLRFEGAGDDWQRWAPMVVQVEEGGPGeT-LLHwLADTQSARHQGVmLMHSEQSLTRVADFWQQRL 112
                     7***********************99999************************88864.4444999***************************** PP

         DUF4123  90 qvrlpdgeavllRfydprvlrallptldeeqrs 122
                     ++r pdg+ + lR + p+vlr +++tl+ e+++
  WP_022632810.1 113 RCRYPDGTLAQLRSHVPDVLRLWWQTLNVEEQT 145
                     ****************************99987 PP

  == domain 2  score: -1.7 bits;  conditional E-value: 0.18
         DUF4123  65 gpslglllaS.aapleelarhLrs 87 
                     g+s  + + S +a +e+++ h+++
  WP_022632810.1 284 GDSIRI-FKSeSAQVEDVRLHYHR 306
                     444444.33303355666666654 PP



Or compare WP_022632810.1 to CDD or PaperBLAST