WP_022632810.1 has 322 amino acids
Query: DUF4123 [M=119] Accession: PF13503.11 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-28 84.0 4.2 5e-28 84.0 4.2 1.9 2 WP_022632810.1 Domain annotation for each sequence (and alignments): >> WP_022632810.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.0 4.2 5e-28 5e-28 1 118 [. 19 145 .. 19 146 .. 0.94 2 ? -1.8 0.0 0.19 0.19 61 61 .. 284 284 .. 240 320 .. 0.54 Alignments for each domain: == domain 1 score: 84.0 bits; conditional E-value: 5e-28 DUF4123 1 lYallDgaldpellellealsgeaase...LyagtpeeelaevgPwLveleda....sallr..eeegwgpslgw.llaSalplealaahlrsll 85 lYa++D++++p+l++ ++a++++ a+ L + +++++++++P++v++e++ + ll ++++ ++++g+ l++S+++l ++a+ ++++l WP_022632810.1 19 LYAIVDPMRYPALPDFWRAFQPRSAQIwqrLRFEGAGDDWQRWAPMVVQVEEGgpgeT-LLHwlADTQSARHQGVmLMHSEQSLTRVADFWQQRL 112 7***********************99999************************99963.33347899999999999******************* PP DUF4123 86 qvrlpdgeevllRfydprvlrallqtldeeqrs 118 ++r+pdg+ + lR + p+vlr ++qtl+ e+++ WP_022632810.1 113 RCRYPDGTLAQLRSHVPDVLRLWWQTLNVEEQT 145 ****************************99987 PP == domain 2 score: -1.8 bits; conditional E-value: 0.19 DUF4123 61 g 61 g WP_022632810.1 284 G 284 2 PP
Or compare WP_022632810.1 to CDD or PaperBLAST