WP_022632810.1 has 322 amino acids
Query: DUF4123 [M=123] Accession: PF13503.10 Description: Domain of unknown function (DUF4123) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-27 82.1 5.3 1.9e-27 82.1 5.3 1.9 2 WP_022632810.1 Domain annotation for each sequence (and alignments): >> WP_022632810.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.1 5.3 1.9e-27 1.9e-27 1 122 [. 19 145 .. 19 146 .. 0.94 2 ? -1.7 0.0 0.18 0.18 65 87 .. 284 306 .. 245 321 .. 0.57 Alignments for each domain: == domain 1 score: 82.1 bits; conditional E-value: 1.9e-27 DUF4123 1 lYaLlDgaadpellelleaesgeaase...LyagtpeeelaevgPwLveledasel.sallr.leeegwgpslgl.llaSaapleelarhLrsll 89 lYa++D +++p+l++ ++a++++ a+ L + +++++++++P++v++e++ + + ll l++++++++ g+ l++S+++l ++a+ ++++l WP_022632810.1 19 LYAIVDPMRYPALPDFWRAFQPRSAQIwqrLRFEGAGDDWQRWAPMVVQVEEGGPGeT-LLHwLADTQSARHQGVmLMHSEQSLTRVADFWQQRL 112 7***********************99999************************88864.4444999***************************** PP DUF4123 90 qvrlpdgeavllRfydprvlrallptldeeqrs 122 ++r pdg+ + lR + p+vlr +++tl+ e+++ WP_022632810.1 113 RCRYPDGTLAQLRSHVPDVLRLWWQTLNVEEQT 145 ****************************99987 PP == domain 2 score: -1.7 bits; conditional E-value: 0.18 DUF4123 65 gpslglllaS.aapleelarhLrs 87 g+s + + S +a +e+++ h+++ WP_022632810.1 284 GDSIRI-FKSeSAQVEDVRLHYHR 306 444444.33303355666666654 PP
Or compare WP_022632810.1 to CDD or PaperBLAST